Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FTMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FTMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03296A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FTMT |
| Target Synonyms | MTF; FTMT | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN | Uniprot ID | Q8N4E7 |
Uniprot Id
Q8N4E7
Target Species
Human
Target Name
FTMT
Target Full Name
Ferritin, mitochondrial
Target Function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Ferritin family
Target Tissue Specificity
Detected in testis and erythroleukemia. Expression is very low or not detectable in brain, colon, heart, kidney, liver, lung, muscle, placental, spleen and small intestine.
Target Synonyms
FerH; Ferritin; Ferritin H subunit; Ferritin; mitochondrial; Fth 3; Fth3; FTMT; FTMT_HUMAN; mitochondrial; Mitochondrial ferritin; MTF; OTTHUMP00000159158
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
