Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FTSJ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-329 of human FTSJ1 (NP_036412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FTSJ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-329 of human FTSJ1 (NP_036412.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01844A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FTSJ1 |
| Target Synonyms | JM23; MRX9; SPB1; CDLIV; MRX44; TRMT7; XLID9; FTSJ1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse ovary, Rat thymus, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-329 of human FTSJ1 (NP_036412.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP | Uniprot ID | Q9UET6 |
Uniprot Id
Q9UET6
Target Species
Human
Target Name
FTSJ1
Target Full Name
tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
Target Function
Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs.
Target Involvement
Mental retardation, X-linked 44 (MRX44)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, RNA methyltransferase RlmE family, TRM7 subfamily
Target Tissue Specificity
Found in fetal brain, lung, liver and kidney. In the adult brain, expressed in amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CDLIV; FTSJ 1; FtsJ homolog 1 (E. coli); FtsJ homolog 1; FtsJ RNA methyltransferase homolog 1; FTSJ1; JM23; Mental retardation X linked 44; Mental retardation X linked 9; MRX44 ; MRX9; Protein ftsJ homolog 1; Putative ribosomal RNA methyltransferase 1; RRMJ1; RRMJ1_HUMAN; rRNA (uridine 2' O ) methyltransferase ; rRNA (uridine-2''-O-)-methyltransferase; SPB1; TRM7
Target Background
This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
