Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 253-395 of human FUCA1 (NP_000138.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FUCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 253-395 of human FUCA1 (NP_000138.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fuca1 |
| Target Synonyms | FUCA; FUCA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 253-395 of human FUCA1 (NP_000138.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSIDKFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAV | Uniprot ID | P04066 |
Uniprot Id
P04066
Target Species
Human
Target Name
FUCA1
Target Full Name
Tissue alpha-L-fucosidase
Target Function
Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
Target Involvement
Fucosidosis (FUCA1D)
Target Subcellular Location
Lysosome.
Target Protein Families
Glycosyl hydrolase 29 family
Target Synonyms
Alpha L fucosidase I; Alpha L fucoside fucohydrolase; Alpha-L-fucosidase 1; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; FUCA; FUCA1; FUCO_HUMAN; fucosidase; alpha-L; tissue; fucosidase; alpha-L- 1; tissue; Tissue alpha L fucosidase; Tissue alpha-L-fucosidase
Target Background
The protein encoded by this gene is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. Mutations in this gene are associated with fucosidosis (FUCA1D), which is an autosomal recessive lysosomal storage disease. A pseudogene of this locus is present on chr 2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
