Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUNDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-155 of human FUNDC1 (NP_776155.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FUNDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-155 of human FUNDC1 (NP_776155.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07939A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUNDC1 |
| Target Synonyms | FUNDC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-155 of human FUNDC1 (NP_776155.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS | Uniprot ID | Q8IVP5 |
Uniprot Id
Q8IVP5
Target Species
Human
Target Name
FUNDC1
Target Full Name
FUN14 domain-containing protein 1
Target Function
Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
FUN14 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
FUNDC1; FUN14 domain-containing protein 1
Target Background
This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
