-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Furin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-794 of human Furin (NP_002560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Furin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-794 of human Furin (NP_002560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09609A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FURIN |
| Target Synonyms | FUR; PACE; SPC1; PCSK3; Furin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, Mouse ovary | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-794 of human Furin (NP_002560.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL | Uniprot ID | P09958 |
Uniprot Id
P09958
Target Species
Human
Target Name
FURIN
Target Full Name
Furin
Target Function
Ubiquitous endoprotease within constitutive secretory pathways capable of cleavage at the RX(K/R)R consensus motif. Mediates processing of TGFB1, an essential step in TGF-beta-1 activation. Converts through proteolytic cleavage the non-functional Brain natriuretic factor prohormone into its active hormone BNP(1-32).; (Microbial infection) Cleaves and activates diphtheria toxin DT.; (Microbial infection) Cleaves and activates anthrax toxin protective antigen (PA).; (Microbial infection) Required for H7N1 and H5N1 influenza virus infection probably by cleaving hemagglutinin.; (Microbial infection) Able to cleave S.pneumoniae serine-rich repeat protein PsrP.; (Microbial infection) Facilitates human coronaviruses EMC and SARS-CoV-2 infections by proteolytically cleaving the spike protein at the monobasic S1/S2 cleavage site. This cleavage is essential for spike protein-mediated cell-cell fusion and entry into human lung cells.; (Microbial infection) Facilitates mumps virus infection by proteolytically cleaving the viral fusion protein F.
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Secreted. Endosome membrane; Single-pass type I membrane protein.
Target Protein Families
Peptidase S8 family, Furin subfamily
Target Tissue Specificity
Seems to be expressed ubiquitously.
Target Synonyms
FURIN; FUR; PACE; PCSK3; Furin; Dibasic-processing enzyme; Paired basic amino acid residue-cleaving enzyme; PACE
Target Background
This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membrane bound protease that is expressed in many tissues, including neuroendocrine, liver, gut, and brain. The encoded protein undergoes an initial autocatalytic processing event in the ER and then sorts to the trans-Golgi network through endosomes where a second autocatalytic event takes place and the catalytic activity is acquired. Like other members of this convertase family, the product of this gene specifically cleaves substrates at single or paired basic residues. Some of its substrates include proparathyroid hormone, transforming growth factor beta 1 precursor, proalbumin, pro-beta-secretase, membrane type-1 matrix metalloproteinase, beta subunit of pro-nerve growth factor and von Willebrand factor. It is thought to be one of the proteases responsible for the activation of HIV envelope glycoproteins gp160 and gp140, and may play a role in tumor progression. Unlike SARS-CoV and other coronaviruses, the spike protein of SARS-CoV-2 is thought to be uniquely cleaved by this protease. Alternative splicing results in multiple transcript variants.
Notification