Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUT6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FUT6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04043A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUT6 |
| Target Synonyms | FT1A; FCT3A; Fuc-TVI; FucT-VI; FUT6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT | Uniprot ID | P51993 |
Uniprot Id
P51993
Target Species
Human
Target Name
FUT6
Target Full Name
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6
Target Function
Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein- or a glycolipid-linked sialopolylactosamines chain or of a distal or internal lactosamine unit of a neutral glycoprotein- or a glycolipid-linked polylactosamines chain through an alpha-1,3 glycosidic linkage and participates in surface expression of the sialyl Lewis X (sLe(x)), Lewis X (Le(x)) and non sialylated VIM2 determinants. Moreover transfers fucose to H-type 2 (Fucalpha1-2Galbeta1-4GlcNAc) chain acceptor substrates and participates in difucosylated sialyl Lewis x determinants. Also fucosylates a polylactosamine substrate having a 6 sulfate modification at the GlcNAc moiety and gives rise to sialyl and non-sialyl 6-sulfo lewis X. Does not have activity towards type 1 ((Galbeta1-3GlcNAc)) and H-type 1 chain (Fucalpha1-2Galbeta1-3GlcNAc) acceptors substrates.; Does not have alpha(1,3)-fucosyltransferase activity.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Golgi apparatus. Secreted. Note=Membrane-bound form in trans cisternae of Golgi.
Target Protein Families
Glycosyltransferase 10 family
Target Tissue Specificity
Kidney, liver, colon, small intestine, bladder, uterus and salivary gland.
Target Synonyms
FUT6; FCT3A; 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6; Fucosyltransferase 6; Fucosyltransferase VI; Fuc-TVI; FucT-VI; Galactoside 3-L-fucosyltransferase
Target Background
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
