-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUT7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human FUT7 (NP_004470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FUT7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human FUT7 (NP_004470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01000A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUT7 |
| Target Synonyms | FucT-VII; FUT7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FUT7 (NP_004470.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVD | Uniprot ID | Q11130 |
Uniprot Id
Q11130
Target Species
Human
Target Name
FUT7
Target Full Name
Alpha-(1,3)-fucosyltransferase 7
Target Function
Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein or a glycolipid-linked sialopolylactosamines chain through an alpha-1,3 glycosidic linkage and participates in the final fucosylation step in the biosynthesis of the sialyl Lewis X (sLe(x)), a carbohydrate involved in cell and matrix adhesion during leukocyte trafficking and fertilization. In vitro, also synthesizes sialyl-dimeric-Lex structures, from VIM-2 structures and both di-fucosylated and trifucosylated structures from mono-fucosylated precursors. However does not catalyze alpha 1-3 fucosylation when an internal alpha 1-3 fucosylation is present in polylactosamine chain and the fucosylation rate of the internal GlcNAc residues is reduced once fucose has been added to the distal GlcNAc. Also catalyzes the transfer of a fucose from GDP-beta-fucose to the 6-sulfated a(2,3)sialylated substrate to produce 6-sulfo sLex mediating significant L-selectin-dependent cell adhesion. Through sialyl-Lewis(x) biosynthesis, can control SELE- and SELP-mediated cell adhesion with leukocytes and allows leukocytes tethering and rolling along the endothelial tissue thereby enabling the leukocytes to accumulate at a site of inflammation. May enhance embryo implantation through sialyl Lewis X (sLeX)-mediated adhesion of embryo cells to endometrium. May affect insulin signaling by upregulating the phosphorylation and expression of some signaling molecules involved in the insulin-signaling pathway through SLe(x) which is present on the glycans of the INSRR alpha subunit
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi.
Target Protein Families
Glycosyltransferase 10 family
Target Tissue Specificity
Leukocytic/myeloid lineage cells.
Target Synonyms
3)-fucosyltransferase; Alpha (1,3) fucosyltransferase 7; Alpha (1,3) fucosyltransferase; Alpha-(1; Fuc-TVII; Fucosyltransferase 7 (alpha (1,3) fucosyltransferase); Fucosyltransferase 7; Fucosyltransferase VII; FucT VII; FucT-VII; FUT7; FUT7_HUMAN; Galactoside 3 L fucosyltransferase; Galactoside 3-L-fucosyltransferase; Selectin ligand synthase
Notification