Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FXYD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human FXYD6 (NP_071286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FXYD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human FXYD6 (NP_071286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10217A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FXYD6 |
| Target Synonyms | FXYD6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human FXYD6 (NP_071286.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN | Uniprot ID | Q9H0Q3 |
Uniprot Id
Q9H0Q3
Target Species
Human
Target Name
FXYD6
Target Full Name
FXYD domain-containing ion transport regulator 6
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
FXYD family
Target Synonyms
FXYD6; UNQ521/PRO1056FXYD domain-containing ion transport regulator 6; Phosphohippolin
Target Background
This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na, K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
