-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FXYD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human FXYD7 (NP_071289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FXYD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human FXYD7 (NP_071289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00612A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FXYD7 |
| Target Synonyms | FXYD7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human FXYD7 (NP_071289.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV | Uniprot ID | P58549 |
Uniprot Id
P58549
Target Species
Human
Target Name
FXYD7
Target Full Name
FXYD domain-containing ion transport regulator 7
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
FXYD family
Target Synonyms
FXYD7; FXYD domain-containing ion transport regulator 7
Target Background
This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na, K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000]
Notification