-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FYB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 678-829 of human FYB (NP_001456.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FYB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 678-829 of human FYB (NP_001456.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04691A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FYB |
| Target Synonyms | FYB; ADAP; THC3; PRO0823; SLAP130; SLAP-130 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 678-829 of human FYB (NP_001456.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NEGSSFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIYDND | Uniprot ID | O15117 |
Uniprot Id
O15117
Target Species
Human
Target Name
FYB1
Target Full Name
FYN-binding protein 1
Target Function
Acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. May play a role in linking T-cell signaling to remodeling of the actin cytoskeleton. Modulates the expression of IL2. Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.
Target Involvement
Thrombocytopenia 3 (THC3)
Target Subcellular Location
Cytoplasm. Nucleus. Cell junction.
Target Tissue Specificity
Expressed in hematopoietic tissues such as myeloid and T-cells, spleen and thymus. Not expressed in B-cells, nor in non-lymphoid tissues.
Target Synonyms
ADAP; Adhesion and degranulation promoting adaptor protein; FYB 120/130; Fyb; FYB-120/130; FYB_HUMAN; FYN binding protein; FYN T binding protein; FYN-binding protein; FYN-T-binding protein; p120/p130; PRO0823; SLAP 130; SLAP-130; SLAP130; SLP 76 associated phosphoprotein; SLP-76-associated phosphoprotein; SLP76 associated phosphoprotein
Target Background
The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene.
Notification