Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against G0S2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human G0S2 (NP_056529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against G0S2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human G0S2 (NP_056529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10856A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | G0S2 |
| Target Synonyms | G0S2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human G0S2 (NP_056529.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ | Uniprot ID | P27469 |
Uniprot Id
P27469
Target Species
Human
Target Name
G0S2
Target Full Name
G0/G1 switch protein 2
Target Function
Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.
Target Subcellular Location
Mitochondrion.
Target Tissue Specificity
Widely expressed with highest levels in peripheral blood, skeletal muscle and heart, followed by kidney and liver.
Target Synonyms
G0/G1 switch regulatory protein 2; G0/G1switch 2; G0s2; G0S2_HUMAN; OTTHUMP00000034644; Putative lymphocyte G0/G1 switch protein 2 ; RP1 28O10.2
Target Background
Involved in extrinsic apoptotic signaling pathway and positive regulation of extrinsic apoptotic signaling pathway. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
