Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against G2E3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human G2E3 (NP_060239.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against G2E3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human G2E3 (NP_060239.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05659A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | G2E3 |
| Target Synonyms | PHF7B; KIAA1333; G2E3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Mouse brain, Mouse eye, Mouse liver, OVCAR3, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human G2E3 (NP_060239.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI | Uniprot ID | Q7L622 |
Uniprot Id
Q7L622
Target Species
Human
Target Name
G2E3
Target Full Name
G2/M phase-specific E3 ubiquitin-protein ligase
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Essential in early embryonic development to prevent apoptotic death.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm.
Target Tissue Specificity
Predominantly expressed in brain, liver, kidney, testes and ovary.
Target Synonyms
G2E3; KIAA1333G2/M phase-specific E3 ubiquitin-protein ligase; EC 2.3.2.26; G2/M phase-specific HECT-type E3 ubiquitin transferase
Target Background
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in apoptotic process and protein ubiquitination. Predicted to act upstream of or within blastocyst development; negative regulation of intrinsic apoptotic signaling pathway; and protein polyubiquitination. Located in Golgi apparatus and cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
