-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against G3BP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against G3BP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-16947A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | G3BP1 |
| Target Synonyms | G3BP; HDH-VIII; G3BP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse testis, PC-3, Rat testis | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM | Uniprot ID | Q13283 |
Uniprot Id
Q13283
Target Species
Human
Target Name
G3BP1
Target Full Name
Ras GTPase-activating protein-binding protein 1
Target Function
ATP- and magnesium-dependent helicase that plays an essential role in innate immunity. Participates in the DNA-triggered cGAS/STING pathway by promoting the DNA binding and activation of CGAS. Enhances also DDX58-induced type I interferon production probably by helping DDX58 at sensing pathogenic RNA. In addition, plays an essential role in stress granule formation. Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3' tail or hanging tails at both 5'- and 3'-ends. Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency. Acts unidirectionally by moving in the 5' to 3' direction along the bound single-stranded DNA. Phosphorylation-dependent sequence-specific endoribonuclease in vitro. Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3'-UTR.
Target Subcellular Location
Cytoplasm, cytosol. Perikaryon. Cytoplasm, Stress granule. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ATP dependent DNA helicase VIII; ATP-dependent DNA helicase VIII; G3BP; G3BP stress granule assembly factor 1; G3BP-1; G3bp1; G3BP1_HUMAN; GAP binding protein; GAP SH3 domain binding protein 1; GAP SH3 domain-binding protein 1; GTPase activating protein (SH3 domain) binding protein 1; hDH VIII; Human DNA helicase VIII; MGC111040; Ras GTPase activating protein binding protein 1; Ras GTPase activating protein SH3 domain binding protein ; Ras GTPase-activating protein-binding protein 1; RasGAP associated endoribonuclease G3BP
Target Background
This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Notification