-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against G6PD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against G6PD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15995A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | G6PD |
| Target Synonyms | G6PD1; G6PD | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG | Uniprot ID | P11413 |
Uniprot Id
P11413
Target Species
Human
Target Name
G6PD
Target Full Name
Glucose-6-phosphate 1-dehydrogenase
Target Function
Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis.
Target Involvement
Anemia, non-spherocytic hemolytic, due to G6PD deficiency (NSHA)
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein.
Target Protein Families
Glucose-6-phosphate dehydrogenase family
Target Tissue Specificity
Isoform Long is found in lymphoblasts, granulocytes and sperm.
Target Research Area
Cancer
Target Synonyms
G6PD; G6PD_HUMAN; G6PD1; G6pdx; Glucose 6 phosphate 1 dehydrogenase; Glucose 6 phosphate dehydrogenase; Glucose 6 phosphate dehydrogenase, G6PD; Glucose-6-phosphate 1-dehydrogenase; MET19; POS10; Zwf1p
Target Background
This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.
Notification