Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GAB1 (NP_997006.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GAB1 (NP_997006.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05582A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GAB1 |
| Target Synonyms | DFNB26; GAB1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GAB1 (NP_997006.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPLAINTAPPSTQ | Uniprot ID | Q13480 |
Uniprot Id
Q13480
Target Species
Human
Target Name
GAB1
Target Full Name
GRB2-associated-binding protein 1
Target Function
Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Involved in the MET/HGF-signaling pathway.
Target Protein Families
GAB family
Target Synonyms
Gab 1; GAB1; GAB1_HUMAN; GRB 2 associated binder 1; GRB 2 associated binding protein 1; GRB2 associated binding protein 1 isoform a; GRB2 associated binding protein 1 isoform b; GRB2-associated binder 1; GRB2-associated-binding protein 1; Growth factor receptor bound protein 2-associated protein 1
Target Background
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
