-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABA A Receptor beta 2 (GABRB2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 2 (GABRB2) (GABRB2) (P47870) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABA A Receptor beta 2 (GABRB2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 2 (GABRB2) (GABRB2) (P47870) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13759A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABA A Receptor beta 2 (GABRB2) |
| Target Synonyms | DEE92; ICEE2; GABA A Receptor beta 2 (GABRB2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, Mouse spleen, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 2 (GABRB2) (GABRB2) (P47870). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDP | Uniprot ID | P47870 |
Uniprot Id
P47870
Target Species
Human
Target Name
GABRB2
Target Full Name
Gamma-aminobutyric acid receptor subunit beta-2
Target Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha1/beta2/gamma2 receptor and the alpha2/beta2/gamma2 receptor exhibit synaptogenic activity. Functions also as histamine receptor and mediates cellular responses to histamine.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRB2 sub-subfamily
Target Tissue Specificity
Isoform 1 and isoform 2 show reduced expression in schizophrenic brain. Isoform 3 shows increased expression in schizophrenic and bipolar disorder brains while isoform 4 shows reduced expression.
Target Research Area
Neuroscience, More proteins and peptides
Target Synonyms
GABA; GABA(A) receptor beta 2; GABA(A) receptor subunit beta-2; GABA-A receptor, beta-2 polypeptide; GABRB2; Gamma aminobutyric acid (GABA) A receptor, beta 2; Gamma aminobutyric acid A receptor beta 2; Gamma-aminobutyric acid receptor subunit beta-2; Gamma-aminobutyric-acid receptor subunit beta-2; GBRB2_HUMAN
Target Background
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. Alternative splicing of this gene generates 2 transcript variants, differing by a 114 bp insertion.
Notification