Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GABPA (NP_002031.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GABPA (NP_002031.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11755A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABPA |
| Target Synonyms | NFT2; NRF2; NRF2A; E4TF1A; E4TF1-60; RCH04A07; GABPA | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Raji, Rat liver, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GABPA (NP_002031.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK | Uniprot ID | Q06546 |
Uniprot Id
Q06546
Target Species
Human
Target Name
GABPA
Target Full Name
GA-binding protein alpha chain
Target Function
Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Synonyms
NFT2; NRF2; NRF2A; E4TF1A; E4TF1-60; RCH04A07; GABPA
Target Background
This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype. Two transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
