-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABRA2 (NP_000798.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABRA2 (NP_000798.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10229A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRA2 |
| Target Synonyms | DEE78; EIEE78; GABRA2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABRA2 (NP_000798.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP | Uniprot ID | P47869 |
Uniprot Id
P47869
Target Species
Human
Target Name
GABRA2
Target Full Name
Gamma-aminobutyric acid receptor subunit alpha-2
Target Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha2/beta2/gamma2 receptor exhibits synaptogenic activity whereas the alpha2/beta3/gamma2 receptor shows very little or no synaptogenic activity.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Cell projection, dendrite.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRA2 sub-subfamily
Target Synonyms
GABA A receptor subunit alpha 2; GABA; GABA(A) receptor subunit alpha 2; GABA(A) receptor subunit alpha-2; GABR A2; GABRA 2; GABRA2; GABRA2 protein; Gamma aminobutyric acid (GABA) A receptor alpha 2 ; Gamma aminobutyric acid A receptor alpha 2; Gamma aminobutyric acid receptor alpha 2 subunit; Gamma aminobutyric acid receptor subunit alpha 2; Gamma-aminobutyric acid receptor subunit alpha-2; GBRA2_HUMAN
Target Background
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification