Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 344-453 of human GABRA6 (NP_000802.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 344-453 of human GABRA6 (NP_000802.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03217A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRA6 |
| Target Synonyms | GABRA6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-1080, Mouse brain, Mouse liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 344-453 of human GABRA6 (NP_000802.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE | Uniprot ID | Q16445 |
Uniprot Id
Q16445
Target Species
Human
Target Name
GABRA6
Target Full Name
Gamma-aminobutyric acid receptor subunit alpha-6
Target Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRA6 sub-subfamily
Target Synonyms
GABA A; GABA A Receptor alpha 6 polypeptide; GABA A receptor alpha 6; GABA A receptor subunit alpha 6; GABA subunit A receptor alpha 6; GABA(A) receptor subunit alpha-6; GABRA 6; GABRA6; Gamma aminobutyric acid A receptor alpha 6; Gamma aminobutyric acid GABA A receptor alpha 6; Gamma aminobutyric acid receptor subunit alpha 6; Gamma-aminobutyric acid receptor subunit alpha-6; GBRA6_HUMAN; MGC116903; MGC116904
Target Background
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
