Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GABRG1 (NP_775807.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GABRG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GABRG1 (NP_775807.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05780A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRG1 |
| Target Synonyms | GABRG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GABRG1 (NP_775807.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIM | Uniprot ID | Q8N1C3 |
Uniprot Id
Q8N1C3
Target Species
Human
Target Name
GABRG1
Target Full Name
Gamma-aminobutyric acid receptor subunit gamma-1
Target Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRG1 sub-subfamily
Target Synonyms
GABRG1; Gamma-aminobutyric acid receptor subunit gamma-1; GABA(A) receptor subunit gamma-1
Target Background
The protein encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
