-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GABRR1 (NP_002033.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GABRR1 (NP_002033.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRR1 |
| Target Synonyms | GABRR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GABRR1 (NP_002033.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLR | Uniprot ID | P24046 |
Uniprot Id
P24046
Target Species
Human
Target Name
GABRR1
Target Full Name
Gamma-aminobutyric acid receptor subunit rho-1
Target Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-1 GABA receptor could play a role in retinal neurotransmission.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRR1 sub-subfamily
Target Tissue Specificity
Highly expressed in the retina and in a lesser extent in brain, lung and thymus.
Target Synonyms
bA135P14.1 (gamma-aminobutyric acid (GABA) receptor rho 1); GABA(A) receptor subunit rho-1; GABA(C) receptor; GABRR1; gamma aminobutyric acid receptor rho 1; gamma-aminobutyric acid (GABA) A receptor rho-1; gamma-aminobutyric acid (GABA) receptor rho 1; Gamma-aminobutyric acid receptor subunit rho-1; GBRR1_HUMAN; MGC163216
Target Background
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Several transcript variants encoding different isoforms have been found for this gene.
Notification