Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01264A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRR2 |
| Target Synonyms | GABRR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, HL-60 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVQERKERKLREKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRLIFP | Uniprot ID | P28476 |
Uniprot Id
P28476
Target Species
Human
Target Name
GABRR2
Target Full Name
Gamma-aminobutyric acid receptor subunit rho-2
Target Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-2 GABA receptor could play a role in retinal neurotransmission.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRR2 sub-subfamily
Target Synonyms
GABRR2; Gamma-aminobutyric acid receptor subunit rho-2; GABA(A) receptor subunit rho-2; GABA(C) receptor
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
