Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GADD45G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GADD45G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GADD45G |
| Target Synonyms | CR6; DDIT2; GRP17; GADD45gamma; GADD45G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW264.7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE | Uniprot ID | O95257 |
Uniprot Id
O95257
Target Species
Human
Target Name
GADD45G
Target Full Name
Growth arrest and DNA damage-inducible protein GADD45 gamma
Target Function
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Target Protein Families
GADD45 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CR6; Cytokine responsive protein CR6; Cytokine-responsive protein CR6; DDIT-2; DDIT2; DNA damage-inducible transcript 2 protein; GA45G_HUMAN; Gadd45g; Growth arrest and DNA damage inducible gamma ; Growth arrest and DNA damage-inducible protein GADD45 gamma; GRP17
Target Background
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
