Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Galectin 4/LGALS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Galectin 4/LGALS4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06731A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Galectin 4/LGALS4 |
| Target Synonyms | GAL4; L36LBP; Galectin 4/LGALS4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116, Mouse large intestine, Rat large intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAA | Uniprot ID | P56470 |
Uniprot Id
P56470
Target Species
Human
Target Name
LGALS4
Target Full Name
Galectin-4
Target Function
Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Target Synonyms
Antigen NY CO 27; Antigen NY-CO-27; Antigen NYCO27; GAL 4; Gal-4; GAL4; Galectin 4; Galectin-4; Galectin4; Homo sapiens galectin4 mRNA complete cds ; L 36 lactose binding protein; L-36 lactose-binding protein; L36 lactose binding protein; L36LBP; Lactose binding lectin 4; Lactose-binding lectin 4; Lectin galactoside binding soluble 4; LEG4_HUMAN; LGALS4
Target Background
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
