-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GALNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 43-160 of human GALNT3 (NP_004473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GALNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 43-160 of human GALNT3 (NP_004473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05900A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GALNT3 |
| Target Synonyms | HHS; HFTC; HFTC1; GalNAc-T3; GALNT3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 43-160 of human GALNT3 (NP_004473.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISL | Uniprot ID | Q14435 |
Uniprot Id
Q14435
Target Species
Human
Target Name
GALNT3
Target Full Name
Polypeptide N-acetylgalactosaminyltransferase 3
Target Function
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5. Probably glycosylates fibronectin in vivo. Glycosylates FGF23. Plays a central role in phosphate homeostasis.
Target Involvement
Tumoral calcinosis, hyperphosphatemic, familial (HFTC)
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Resides preferentially in the trans and medial parts of the Golgi stack.
Target Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Target Tissue Specificity
Expressed in organs that contain secretory epithelial glands. Highly expressed in pancreas, skin, kidney and testis. Weakly expressed in prostate, ovary, intestine and colon. Also expressed in placenta and lung and fetal lung and fetal kidney.
Target Synonyms
DKFZp686C10199; EC 2.4.1.41; GalNAc T3; GalNAc transferase 3; GalNAc-T3; GalNAcT3; GALNT3; GALT3_HUMAN; HFTC; HHS; MGC61909; OTTHUMP00000204915; OTTHUMP00000204919; Polypeptide GalNAc transferase 3; Polypeptide GalNAc transferase T3; Polypeptide N acetylgalactosaminyltransferase 3; Polypeptide N-acetylgalactosaminyltransferase 3; pp-GaNTase 3; ppGaNTase 3; Protein UDP acetylgalactosaminyltransferase 3; Protein-UDP acetylgalactosaminyltransferase 3; RP23-306G16.2; UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 3 ; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 3 (GalNAc T3); UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3
Target Background
This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities.
Notification