Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GALNT6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human GALNT6 (NP_009141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GALNT6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human GALNT6 (NP_009141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05414A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GALNT6 |
| Target Synonyms | GalNAcT6; GALNAC-T6; GALNT6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human GALNT6 (NP_009141.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVSSREEATEKPWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKH | Uniprot ID | Q8NCL4 |
Uniprot Id
Q8NCL4
Target Species
Human
Target Name
GALNT6
Target Full Name
Polypeptide N-acetylgalactosaminyltransferase 6
Target Function
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Target Tissue Specificity
Expressed in placenta and trachea. Weakly expressed in brain and pancreas. Expressed in fibroblast. Weakly or not expressed in lung, liver, muscle, kidney, spleen, thymus, prostate, testis, ovary, intestine, colon, leukocyte, stomach, thyroid, spinal cord
Target Synonyms
GALNAC T6; GalNAc transferase 6; GalNAc-T6; GalNAcT6; GALNT 6; GALNT6; GALT6_HUMAN; Polypeptide GalNAc transferase 6; Polypeptide N acetylgalactosaminyltransferase 6; Polypeptide N-acetylgalactosaminyltransferase 6; pp GaNTase 6; pp-GaNTase 6; Protein UDP acetylgalactosaminyltransferase 6; Protein-UDP acetylgalactosaminyltransferase 6; UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 6; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 6 (GalNAc T6); UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 6; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
