Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GANC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GANC (NP_937784.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GANC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GANC (NP_937784.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00324A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GANC |
| Target Synonyms | GANC | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GANC (NP_937784.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFG | Uniprot ID | Q8TET4 |
Uniprot Id
Q8TET4
Target Species
Human
Target Name
GANC
Target Full Name
Neutral alpha-glucosidase C
Target Function
Has alpha-glucosidase activity.
Target Protein Families
Glycosyl hydrolase 31 family
Target Synonyms
GANC; Neutral alpha-glucosidase C; EC 3.2.1.20
Target Background
Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. This gene encodes a member of glycosyl hydrolases family 31. This enzyme hydrolyses terminal, non-reducing 1, 4-linked alpha-D-glucose residues and releases alpha-D-glucose. This is a key enzyme in glycogen metabolism and its gene localizes to a chromosomal region (15q15) that is associated with susceptibility to diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
