Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GAS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GAS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09213A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GAS2 |
| Target Synonyms | GAS-2; GAS2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT | Uniprot ID | O43903 |
Uniprot Id
O43903
Target Species
Human
Target Name
GAS2
Target Full Name
Growth arrest-specific protein 2
Target Function
May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process.
Target Subcellular Location
Cytoplasm, cytoskeleton, stress fiber. Membrane; Peripheral membrane protein.
Target Protein Families
GAS2 family
Target Tissue Specificity
Ubiquitously expressed with highest levels in liver, lung, and kidney. Not found in spleen.
Target Synonyms
GAS 2; GAS-2; Gas2; GAS2_HUMAN; Growth arrest specific 2; Growth arrest specific protein 2; Growth arrest-specific protein 2; MGC32610
Target Background
The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
