-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GATA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-155 of human GATA1 (NP_002040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against GATA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-155 of human GATA1 (NP_002040.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
| Cat.No | ADA-10386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GATA1 |
| Target Synonyms | GF1; GF-1; NFE1; XLTT; ERYF1; NF-E1; XLANP; XLTDA; GATA-1; HAEADA; GATA1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3 | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 55-155 of human GATA1 (NP_002040.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSS | Uniprot ID | P15976 |
Uniprot Id
P15976
Target Species
Human
Target Name
GATA1
Target Full Name
Erythroid transcription factor
Target Function
Transcriptional activator or repressor which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells. Activates the transcription of genes involved in erythroid differentiation of K562 erythroleukemia cells, including HBB, HBG1/2, ALAS2 and HMBS.
Target Involvement
X-linked dyserythropoietic anemia and thrombocytopenia (XDAT); Thrombocytopenia with beta-thalassemia, X-linked (XLTT); Anemia without thrombocytopenia, X-linked (XLAWT)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Erythrocytes.
Target Synonyms
Anemia; X-linked; without thrombocytopenia; included; ERYF 1; Eryf1; Erythroid transcription factor; Erythrold transcription factor 1; GATA 1; GATA binding factor 1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1; GATA-1; GATA-binding factor 1; GATA1; GATA1_HUMAN; GF 1; GF-1; GF1; Globin transcription factor 1; NF E1; NF E1 DNA binding protein; NF-E1 DNA-binding protein; NFE 1; NFE1 ; Nuclear factor erythroid 1; Transcription factor GATA1; XLANP; XLTDA; XLTT
Target Background
This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.
Notification