Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GATA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 240-340 of human GATA2(NP_116027.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against GATA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 240-340 of human GATA2(NP_116027.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?GATA2 in paraffin-embedded?Human cervical squamous cell carcinoma tissue using?GATA2 Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08399A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GATA2 |
| Target Synonyms | DCML; IMD21; NFE1B; MONOMAC; GATA2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 240-340 of human GATA2(NP_116027.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLS | Uniprot ID | P23769 |
Uniprot Id
P23769
Target Species
Human
Target Name
GATA2
Target Full Name
Endothelial transcription factor GATA-2
Target Function
Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.
Target Involvement
Immunodeficiency 21 (IMD21); Lymphedema, primary, with myelodysplasia (LMPM); Myelodysplastic syndrome (MDS)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Endothelial cells.
Target Synonyms
DCML; Endothelial transcription factor GATA 2; Endothelial transcription factor GATA-2; Endothelial transcription factor GATA2; FLJ45948; GATA 2; GATA binding protein 2; GATA-binding protein 2; Gata2; GATA2_HUMAN; IMD21; MGC2306; MONOMAC; NFE 1B; NFE1B; OTTHUMP00000216240
Target Background
This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
