Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GATA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-160 of human GATA6 (NP_005248.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GATA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-160 of human GATA6 (NP_005248.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00157A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GATA6 |
| Target Synonyms | GATA6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-160 of human GATA6 (NP_005248.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPA | Uniprot ID | Q92908 |
Uniprot Id
Q92908
Target Species
Human
Target Name
GATA6
Target Full Name
Transcription factor GATA-6
Target Function
Transcriptional activator. Regulates SEMA3C and PLXNA2. Involved in gene regulation specifically in the gastric epithelium. May regulate genes that protect epithelial cells from bacterial infection. Involved in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions. In human skin, controls several physiological processes contributing to homeostasis of the upper pilosebaceous unit. Triggers ductal and sebaceous differentiation as well as limits cell proliferation and lipid production to prevent hyperseborrhoea. Mediates the effects of retinoic acid on sebocyte proliferation, differentiation and lipid production. Also contributes to immune regulation of sebocytes and antimicrobial responses by modulating the expression of anti-inflammatory genes such as IL10 and pro-inflammatory genes such as IL6, TLR2, TLR4, and IFNG. Activates TGFB1 signaling which controls the interfollicular epidermis fate.
Target Involvement
Conotruncal heart malformations (CTHM); Atrial septal defect 9 (ASD9); Tetralogy of Fallot (TOF); Atrioventricular septal defect 5 (AVSD5); Pancreatic agenesis and congenital heart defects (PACHD)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in heart, gut and gut-derived tissues. Expressed in skin upper pilosebaceous unit. Expression is decreased or lost in acne lesions.
Target Synonyms
Gata binding factor 6; Gata binding protein 6; GATA-binding factor 6; Gata6; GATA6_HUMAN; Transcription factor Gata 6; Transcription factor GATA-6
Target Background
This gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
