Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GATC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human GATC (NP_789788.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GATC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human GATC (NP_789788.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05811A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GATC |
| Target Synonyms | 15E1.2; COXPD42; GATC | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human GATC (NP_789788.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS | Uniprot ID | O43716 |
Uniprot Id
O43716
Target Species
Human
Target Name
GATC
Target Full Name
Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
Target Function
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Target Subcellular Location
Mitochondrion.
Target Protein Families
GatC family
Target Research Area
others
Target Synonyms
15E1.2; gatC; GatC-like protein; GATCL_HUMAN; Glu AdT subunit C; Glutamyl tRNA(Gln) amidotransferase subunit C mitochondrial; Protein 15E1.2
Target Background
Enables glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. Involved in glutaminyl-tRNAGln biosynthesis via transamidation and mitochondrial translation. Located in mitochondrion. Part of glutamyl-tRNA(Gln) amidotransferase complex. Implicated in combined oxidative phosphorylation deficiency 42.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
