-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06340A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GBF1 |
| Target Synonyms | CMT2GG; CMTDI2; CMTDIA; ARF1GEF; GBF1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA | Uniprot ID | Q92538 |
Uniprot Id
Q92538
Target Species
Human
Target Name
GBF1
Target Full Name
Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Target Function
Guanine-nucleotide exchange factor (GEF) for members of the Arf family of small GTPases involved in trafficking in the early secretory pathway; its GEF activity initiates the coating of nascent vesicles via the localized generation of activated ARFs through replacement of GDP with GTP. Recruitment to cis-Golgi membranes requires membrane association of Arf-GDP and can be regulated by ARF1, ARF3, ARF4 and ARF5. Involved in the recruitment of the COPI coat complex to the endoplasmic reticulum exit sites (ERES), and the endoplasmic reticulum-Golgi intermediate (ERGIC) and cis-Golgi compartments which implicates ARF1 activation. Involved in COPI vesicle-dependent retrograde transport from the ERGIC and cis-Golgi compartments to the endoplasmic reticulum (ER). Involved in the trans-Golgi network recruitment of GGA1, GGA2, GGA3, BIG1, BIG2, and the AP-1 adapter protein complex related to chlathrin-dependent transport; the function requires its GEF activity (probably at least in part on ARF4 and ARF5). Has GEF activity towards ARF1. Has in vitro GEF activity towards ARF5. Involved in the processing of PSAP. Required for the assembly of the Golgi apparatus. The AMPK-phosphorylated form is involved in Golgi disassembly during mitotis and under stress conditions. May be involved in the COPI vesicle-dependent recruitment of PNPLA2 to lipid droplets; however, this function is under debate. In neutrophils, involved in G protein-coupled receptor (GPCR)-mediated chemotaxis und superoxide production. Proposed to be recruited by phosphatidylinositol-phosphates generated upon GPCR stimulation to the leading edge where it recruits and activates ARF1, and is involved in recruitment of GIT2 and the NADPH oxidase complex. Plays a role in maintaining mitochondrial morphology.
Target Subcellular Location
Golgi apparatus, cis-Golgi network. Endoplasmic reticulum-Golgi intermediate compartment. Golgi apparatus, trans-Golgi network. Golgi apparatus. Cytoplasm. Lipid droplet. Membrane; Peripheral membrane protein.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ARF1GEF; BFA resistant GEF 1; BFA-resistant GEF 1; FLJ21263; FLJ21500; GBF1; GBF1_HUMAN; golgi brefeldin A resistant guanine nucleotide exchange factor 1; Golgi specific brefeldin A resistance factor 1; Golgi specific Brefeldin A-resistance factor; Golgi-specific brefeldin A-resistance guanine nucleotide exchange; Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1; KIAA0248; MGC134877; MGC134878
Target Background
This gene encodes a member of the Sec7 domain family. The encoded protein is a guanine nucleotide exchange factor that regulates the recruitment of proteins to membranes by mediating GDP to GTP exchange. The encoded protein is localized to the Golgi apparatus and plays a role in vesicular trafficking by activating ADP ribosylation factor 1. The encoded protein has also been identified as an important host factor for viral replication. Multiple transcript variants have been observed for this gene.
Notification