-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14460A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GBP1 |
| Target Synonyms | GBP1; guanylate-binding protein 1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS | Uniprot ID | P32455 |
Uniprot Id
P32455
Target Species
Human
Target Name
GBP1
Target Full Name
Guanylate-binding protein 1
Target Function
Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions. Exhibits antiviral activity against influenza virus. Promotes oxidative killing and delivers antimicrobial peptides to autophagolysosomes, providing broad host protection against different pathogen classes.
Target Subcellular Location
Cytoplasm. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Cell membrane. Secreted. Note=Secreted from endothelial cells in the cerebrospinal fluid, upon bacterial challenge and independently of IFNG induction. Golgi membrane localization requires isoprenylation and the presence of another IFNG-induced factor.
Target Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Target Synonyms
GBP 1; GBP-1; GBP1; GBP1_HUMAN; GTP binding protein 1; GTP-binding protein 1; Guanine nucleotide binding protein 1; Guanine nucleotide-binding protein 1; Guanylate binding protein 1; Guanylate binding protein 1 interferon inducible 67kDa; Guanylate binding protein 1 interferon inducible; HuGBP 1; HuGBP-1; HuGBP1; Interferon induced guanylate binding protein 1; Interferon-induced guanylate-binding protein 1; OTTHUMP00000012352
Target Background
Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3.
Notification