Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GCLM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GCLM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16556A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GCLM |
| Target Synonyms | GLCLR; GCLM | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, U-2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS | Uniprot ID | P48507 |
Uniprot Id
P48507
Target Species
Human
Target Name
GCLM
Target Full Name
Glutamate--cysteine ligase regulatory subunit
Target Synonyms
Gamma ECS regulatory subunit; Gamma-ECS regulatory subunit; Gamma-glutamylcysteine synthetase regulatory subunit; GCLM; GCS light chain; GLCLR; Glutamate cysteine ligase regulatory subunit; Glutamate--cysteine ligase modifier subunit; Glutamate--cysteine ligase regulatory subunit; GSC light chain; GSH0_HUMAN
Target Background
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
