Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GCSH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-173 of human GCSH (NP_004474.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GCSH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-173 of human GCSH (NP_004474.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15700A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GCSH |
| Target Synonyms | GCE; NKH; GCSH | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 49-173 of human GCSH (NP_004474.2) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE | Uniprot ID | P23434 |
Uniprot Id
P23434
Target Species
Human
Target Name
GCSH
Target Full Name
Glycine cleavage system H protein, mitochondrial
Target Function
The glycine cleavage system catalyzes the degradation of glycine. The H protein (GCSH) shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).
Target Involvement
Non-ketotic hyperglycinemia (NKH)
Target Subcellular Location
Mitochondrion.
Target Protein Families
GcvH family
Target Synonyms
GCSHGlycine cleavage system H protein; mitochondrial; Lipoic acid-containing protein
Target Background
Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
