-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GDNF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 109-211 of human GDNF (NP_000505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GDNF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 109-211 of human GDNF (NP_000505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12716A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GDNF |
| Target Synonyms | ATF; ATF1; ATF2; HSCR3; HFB1-GDNF; GDNF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 109-211 of human GDNF (NP_000505.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI | Uniprot ID | P39905 |
Uniprot Id
P39905
Target Species
Human
Target Name
GDNF
Target Full Name
Glial cell line-derived neurotrophic factor
Target Function
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Target Involvement
Hirschsprung disease 3 (HSCR3); Congenital central hypoventilation syndrome (CCHS); Pheochromocytoma (PCC)
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family, GDNF subfamily
Target Tissue Specificity
In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic
Target Research Area
Neuroscience
Target Synonyms
Astrocyte derived trophic factor ; Astrocyte derived trophic factor 1; Astrocyte-derived trophic factor; ATF 1 ; ATF 2; Atf; ATF1; ATF2; gdnf; GDNF_HUMAN; Glial cell derived neurotrophic factor; Glial Cell Line Derived Neurotrophic Factor; Glial cell line-derived neurotrophic factor; Glial derived neurotrophic factor; HFB1 GDNF; hGDNF; HSCR3
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing.
Notification