Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GFAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-75 of human GFAP (NP_002046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GFAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-75 of human GFAP (NP_002046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of lysates from Mouse brain, using GFAP Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-13068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | gfap |
| Target Synonyms | ALXDRD; GFAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-75 of human GFAP (NP_002046.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMME | Uniprot ID | P14136 |
Uniprot Id
P14136
Target Species
Human
Target Name
GFAP
Target Full Name
Glial fibrillary acidic protein
Target Function
GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Target Involvement
Alexander disease (ALXDRD)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in cells lacking fibronectin.
Target Research Area
Neuroscience
Target Synonyms
ALXDRD; GFAP
Target Background
This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
