Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GFPT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GFPT2 (NP_005101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GFPT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GFPT2 (NP_005101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10098A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GFPT2 |
| Target Synonyms | GFAT; GFAT2; GFAT 2; GFPT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, Rat heart, 293T, A375, Mouse pancreas, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GFPT2 (NP_005101.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFF | Uniprot ID | O94808 |
Uniprot Id
O94808
Target Species
Human
Target Name
GFPT2
Target Full Name
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
Target Function
Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
Target Tissue Specificity
Highest levels of expression in heart, placenta, and spinal cord.
Target Synonyms
D fructose 6 phosphate amidotransferase 2; D-fructose-6-phosphate amidotransferase 2; GFAT 2; GFAT2; Gfpt2; GFPT2_HUMAN; Glucosamine fructose 6 phosphate aminotransferase [isomerizing] 2; glutamine fructose 6 phosphate transaminase 2; Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2; Glutamine:fructose 6 phosphate amidotransferase 2; Glutamine:fructose-6-phosphate amidotransferase 2; Hexosephosphate aminotransferase 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
