Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GGPS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 164-300 of human GGPS1 (NP_001032354.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GGPS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 164-300 of human GGPS1 (NP_001032354.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06788A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GGPS1 |
| Target Synonyms | GGPPS; MDHLO; GGPPS1; MUDHLOV; GGPS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 164-300 of human GGPS1 (NP_001032354.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE | Uniprot ID | O95749 |
Uniprot Id
O95749
Target Species
Human
Target Name
GGPS1
Target Full Name
Geranylgeranyl pyrophosphate synthase
Target Function
Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.
Target Subcellular Location
Cytoplasm.
Target Protein Families
FPP/GGPP synthase family
Target Tissue Specificity
Abundantly expressed in testis. Found in other tissues to a lower extent.
Target Research Area
Cancer
Target Synonyms
(2E; 6E)-farnesyl diphosphate synthase; Dimethylallyltranstransferase; Farnesyl diphosphate synthase; Farnesyltranstransferase; Geranylgeranyl diphosphate synthase 1; Geranylgeranyl diphosphate synthase; Geranylgeranyl pyrophosphate synthase; Geranylgeranyl pyrophosphate synthetase; Geranyltranstransferase; GGPP synthase; GGPP synthetase; GGPPS; GGPPS_HUMAN; GGPPS1; GGPPSase; GGPS1; OTTHUMP00000036073; OTTHUMP00000216161; OTTHUMP00000216163; OTTHUMP00000216164
Target Background
This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
