-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GGT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human GGT5 (NP_001093251.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GGT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human GGT5 (NP_001093251.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10213A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GGT5 |
| Target Synonyms | GGL; GGT 5; GGTLA1; GGT-REL; GGT5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human GGT5 (NP_001093251.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPAVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY | Uniprot ID | P36269 |
Uniprot Id
P36269
Target Species
Human
Target Name
GGT5
Target Full Name
Glutathione hydrolase 5 proenzyme
Target Function
Cleaves the gamma-glutamyl peptide bond of glutathione and glutathione-S-conjugate such as leukotriene C4. Does not cleaves gamma-glutamyl compounds such as gamma-glutamyl leucine. May also catalyze a transpeptidation reaction in addition to the hydrolysis reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Acts as a negative regulator of geranylgeranyl glutathione bioactivity by cleaving off its gamma-glutamyl group, playing a role in adaptive immune responses.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Gamma-glutamyltransferase family
Target Synonyms
GGT5; GGTLA1; Glutathione hydrolase 5 proenzyme; Gamma-glutamyl transpeptidase-related enzyme; GGT-rel; Gamma-glutamyltransferase 5; GGT 5; Gamma-glutamyltransferase-like activity 1; Gamma-glutamyltranspeptidase 5; Leukotriene-C4 hydrolase
Target Background
This gene is a member of the gamma-glutamyl transpeptidase gene family, and some reports indicate that it is capable of cleaving the gamma-glutamyl moiety of glutathione. The protein encoded by this gene is synthesized as a single, catalytically-inactive polypeptide, that is processed post-transcriptionally to form a heavy and light subunit, with the catalytic activity contained within the small subunit. The encoded enzyme is able to convert leukotriene C4 to leukotriene D4, but appears to have distinct substrate specificity compared to gamma-glutamyl transpeptidase. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification