-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GHSR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GHSR (NP_940799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GHSR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GHSR (NP_940799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GHSR |
| Target Synonyms | GHDP; GHSR | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GHSR (NP_940799.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDL | Uniprot ID | Q92847 |
Uniprot Id
Q92847
Target Species
Human
Target Name
GHSR
Target Full Name
Growth hormone secretagogue receptor type 1
Target Function
Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
Target Involvement
Growth hormone deficiency, isolated partial (GHDP)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Pituitary and hypothalamus.
Target Synonyms
GHSR; Growth hormone secretagogue receptor type 1; GHS-R; GH-releasing peptide receptor; GHRP; Ghrelin receptor
Target Background
This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.
Notification