Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-153 of human GIP (NP_004114.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-153 of human GIP (NP_004114.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09518A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GIP |
| Target Synonyms | GIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-153 of human GIP (NP_004114.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR | Uniprot ID | P09681 |
Uniprot Id
P09681
Target Species
Human
Target Name
GIP
Target Full Name
Gastric inhibitory polypeptide
Target Function
Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
Target Subcellular Location
Secreted.
Target Protein Families
Glucagon family
Target Research Area
Signal Transduction
Target Synonyms
Gastric Inhibitory Peptide; Gastric inhibitory polypeptide; Gastric inhibitory polypeptide precursor; GIP; GIP_HUMAN; Glucose dependent insulinotropic polypeptide; Glucose-dependent insulinotropic polypeptide; Incretin hormone
Target Background
This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
