Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against GJA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HeLa cells using GJA5 antibody. Blue: DAPI for nuclear staining.
| Cat.No | ADA-10309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJA5 |
| Target Synonyms | CX40; ATFB11; GJA5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV | Uniprot ID | P36382 |
Uniprot Id
P36382
Target Species
Human
Target Name
GJA5
Target Full Name
Gap junction alpha-5 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Involvement
Atrial standstill 1 (ATRST1); Atrial fibrillation, familial, 11 (ATFB11)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Alpha-type (group II) subfamily
Target Research Area
Others
Target Synonyms
GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
Target Background
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
