-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10894A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJB1 |
| Target Synonyms | CMTX; CX32; CMTX1; GJB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A375, LO2, MCF7, Mouse brain, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC | Uniprot ID | P08034 |
Uniprot Id
P08034
Target Species
Human
Target Name
GJB1
Target Full Name
Gap junction beta-1 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Involvement
Charcot-Marie-Tooth disease, X-linked dominant, 1 (CMTX1); Dejerine-Sottas syndrome (DSS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Beta-type (group I) subfamily
Target Synonyms
GJB1; CX32; Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein
Target Background
This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Notification