-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human GJC2 (Q5T442) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human GJC2 (Q5T442) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00502A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJC2 |
| Target Synonyms | Cx47; HLD2; GJA12; SPG44; CX46.6; LMPH1C; LMPHM3; PMLDAR; GJC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human GJC2 (Q5T442). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVWI | Uniprot ID | Q5T442 |
Uniprot Id
Q5T442
Target Species
Human
Target Name
GJC2
Target Full Name
Gap junction gamma-2 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a role in myelination in central and peripheral nervous systems.
Target Involvement
Leukodystrophy, hypomyelinating, 2 (HLD2); Spastic paraplegia 44, autosomal recessive (SPG44); Lymphedema, hereditary, 1C (LMPH1C)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Gamma-type subfamily
Target Tissue Specificity
Expressed in central nervous system, in sciatic nerve and sural nerve. Also detected in skeletal muscles.
Target Synonyms
GJC2; GJA12; Gap junction gamma-2 protein; Connexin-46.6; Cx46.6; Connexin-47; Cx47; Gap junction alpha-12 protein
Target Background
This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.
Notification