Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJD2 |
| Target Synonyms | CX36; GJA9; GJD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HL-60, Jurkat, Mouse brain, Mouse eye, Mouse pancreas, Rat eye, Rat pancreas, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR | Uniprot ID | Q9UKL4 |
Uniprot Id
Q9UKL4
Target Species
Human
Target Name
GJD2
Target Full Name
Gap junction delta-2 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Delta-type subfamily
Target Tissue Specificity
Highly expressed in neurons.
Target Synonyms
GJD2; GJA9; Gap junction delta-2 protein; Connexin-36; Cx36; Gap junction alpha-9 protein
Target Background
This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
