Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GKN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human GKN1 (NP_062563.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GKN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human GKN1 (NP_062563.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11157A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GKN1 |
| Target Synonyms | FOV; CA11; AMP18; BRICD1; foveolin; GKN1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human GKN1 (NP_062563.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVL | Uniprot ID | Q9NS71 |
Uniprot Id
Q9NS71
Target Species
Human
Target Name
GKN1
Target Full Name
Gastrokine-1
Target Function
Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Target Subcellular Location
Secreted. Cytoplasmic granule. Golgi apparatus.
Target Protein Families
Gastrokine family
Target Tissue Specificity
Expressed in stomach (at protein level). No expression is detected in cancer tissue or gastric cancer cell lines.
Target Research Area
Others
Target Synonyms
18 kDa antrum mucosa protein; AMP 18; AMP-18; AMP18; Antrum mucosa protein, 18-KD; BRICD 1; BRICD1; BRICHOS domain containing 1; CA 11; CA11; CA11 gene; CA11 protein; FOV; Foveolin; Gastrokine-1; Gastrokine1; GKN 1; Gkn1; GKN1_HUMAN; MGC70354; Protein CA11; UNQ489/PRO1005
Target Background
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
