-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLDC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-749 of human GLDC (NP_000161.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GLDC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-749 of human GLDC (NP_000161.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08199A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLDC |
| Target Synonyms | GLDC; GCE; GCSP; HYGN1; glycine decarboxylase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Bewo, Hep G2, Mouse liver, Rat kidney, Rat liver, U-251 MG (Low expression control) | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 580-749 of human GLDC (NP_000161.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSH | Uniprot ID | P23378 |
Uniprot Id
P23378
Target Species
Human
Target Name
GLDC
Target Full Name
Glycine dehydrogenase (decarboxylating), mitochondrial
Target Function
The glycine cleavage system catalyzes the degradation of glycine. The P protein (GLDC) binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein (GCSH).
Target Involvement
Non-ketotic hyperglycinemia (NKH)
Target Subcellular Location
Mitochondrion.
Target Protein Families
GcvP family
Target Synonyms
GCE; GCSP; GCSP_HUMAN; GLDC; Glycine cleavage system P protein; glycine cleavage system protein P; Glycine decarboxylase; glycine decarboxylase P protein ; Glycine dehydrogenase (decarboxylating) mitochondrial; Glycine dehydrogenase [decarboxylating]; mitochondrial; Gycine dehydrogenase (decarboxylating); HYGN1; MGC138198; MGC138200; NKH
Target Background
Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).
Notification