Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLP2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GLP2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09458A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLP2R |
| Target Synonyms | GLP2R | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse brain, Mouse stomach | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI | Uniprot ID | O95838 |
Uniprot Id
O95838
Target Species
Human
Target Name
GLP2R
Target Full Name
Glucagon-like peptide 2 receptor
Target Function
This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Research Area
Cell Biology
Target Synonyms
GLP2R; Glucagon-like peptide 2 receptor; GLP-2 receptor; GLP-2-R; GLP-2R
Target Background
This gene encodes a G protein-coupled receptor that is closely related to the glucagon receptor and binds to glucagon-like peptide-2 (GLP2). Signalling through GLP2 stimulates intestinal growth and increases villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
